100 Best Indian Food Blogs and Websites

Follow Top 100 Indian Food Blogs from one place on Feedspot Reader
The best Indian Food blogs from thousands of blogs on the web and ranked by relevancy, authority, social media followers & freshness.

Indian Food Blogs

Here are 100 Best Indian Food Blogs you should follow in 2024

1. NishaMadhulika

NishaMadhulika Nishamadhulika creates Vegetarian Recipes in Hindi for families worldwide. My mission is to bring joy and togetherness to every home through wholesome and healthy recipes. With you since 2009. Thank you for your love and support, you are my driving force!
youtube.com
Frequency 2 posts / week Since Aug 2009 Get Email Contact Get Influential Bloggers ContactsGet access to 250k active Bloggers in 1500 niche categories.Get targeted media contact list in your niche at your fingertips so you can focus on running your campaign.Email us the type of bloggers you want to reach out for your marketing campaign at anuj@feedspot.com Copy email. We'll share blogger's data in an Excel or CSV format.

2. Sanjeev Kapoor Khazana

Sanjeev Kapoor Khazana A destination for tried and tested recipe videos from India and around the world.
youtube.com
Facebook Followers 5.4MTwitter Followers 2.2MInstagram Followers 1.7M Frequency 4 posts / day Since Jul 2009 Get Email Contact

3. Dassana's Veg Recipes

Dassana's Veg Recipes Vegrecipesofindia.com is a food blog by Dassana Amit, a vegetarian chef who has been sharing tried and tested vegetarian recipes since 2009. The blog has over 2,000 recipes, including Indian, international, and baking recipes. Some of the most popular recipes on the blog include Samosa Recipe, Dal Tadka, Idli Recipe, Pav Bhaji Recipe, and Chilli Paneer Recipe.
vegrecipesofindia.com
Facebook Followers 8Twitter Followers 5Instagram Followers 63.7K Frequency 2 posts / month Domain Authority 64 Get Email Contact

4. Archana's Kitchen

Archana's Kitchen Archana's Kitchen is India's leading recipe and food discovery platform that gives the world a credible and confident 'DIY' solutions for everyday cooking. Its mission is to encourage people to enjoy cooking with simple recipes, with focus on health and nutrition.
archanaskitchen.com
Facebook Followers 1.7MTwitter Followers 11.7KInstagram Followers 373.9K Frequency 2 posts / week Domain Authority 63 Get Email Contact

5. Rak's Kitchen

Rak's Kitchen Learn how to make South Indian recipes, North Indian recipes and eggless baking recipes with step by step pictures and videos!
rakskitchen.net
Facebook Followers 2MTwitter Followers 2.8KInstagram Followers 137.2K Frequency 1 post / month Domain Authority 46 Get Email Contact

6. Manjula's Kitchen

Manjula's Kitchen Covering articles about mouthwatering appetizers, curries, desserts and many more, that are easy to make for all ages. Manjula teaches simple and practical recipes that carry out the authenticity of Indian vegetarian cooking.
manjulaskitchen.com
Facebook Followers 1.7MTwitter Followers 2.6K Frequency 7 posts / month Since Apr 2007 Domain Authority 53 Get Email Contact

7. Vahchef - VahRehVah - Inspire To Cook, Inspire To Taste,

Vahchef - VahRehVah - Inspire To Cook, Inspire To Taste, Amaze your self, family & friends with your Indian cooking skills & knowledge. The essence of good Indian cooking revolves around the appropriate use of aromatic Indian spices & Vahchef - VahR Makes it easy to cook with their videos of vast list of top Indian dishes
youtube.com
Facebook Followers 703.1KTwitter Followers 5.5KInstagram Followers 194.4K Frequency 3 posts / week Since Sep 2007 Get Email Contact

8. Yummy Tummy Aarthi | Recipe

Yummy Tummy Aarthi | Recipe I am on a mission to show you how easy cooking can be. I share recipes with easy step by step pictures which clearly clearly shows you the ease of cooking. I will be giving ideas for your daily cooking by sharing breakfast, lunch & dinner ideas..
yummytummyaarthi.com
Facebook Followers 1.5MTwitter Followers 2.4KInstagram Followers 426.8K Frequency 1 post / month Domain Authority 52 Get Email Contact

9. Vegan Richa

Vegan Richa Richa Hingle is the prolific and award-winning recipe developer, blogger and photographer behind VeganRicha. Her instructions are easy to follow and her step-by-step photographs welcome the uninitiated into their kitchen. She loves to show people how easy it is to cook vegan Indian or other cuisines.
veganricha.com
Facebook Followers 999.1KTwitter Followers 21.6KInstagram Followers 378.2K Frequency 1 post / day Domain Authority 67 Get Email Contact

10. First Timer Cook

First Timer Cook A blog about how simply cooking can be done, how easily cooking can be learned
firsttimercook.com
Facebook Followers 3.8KTwitter Followers 558Instagram Followers 26.6K Frequency 5 posts / day Domain Authority 27 Get Email Contact

11. Masala Herb

Masala Herb MasalaHerb.com is a blog, initiated by Helene D'Souza in 2011. This includes Food section, Recipes with a focus on Goan Food as well as Asian/Indian food.
masalaherb.com
Facebook Followers 15.7KTwitter Followers 11.2KInstagram Followers 9.5K Frequency 2 posts / month Domain Authority 44 Get Email Contact

12. Holy Cow Vegan

Holy Cow Vegan Vegan food blog with easy, healthy, family-friendly recipes everyone will love. I cook, eat and share easy, tasty and nutritious plant-based recipes from my kitchen.
holycowvegan.net
Facebook Followers 17.3KTwitter Followers 1.6KInstagram Followers 8.5K Frequency 10 posts / quarter Domain Authority 55 Get Email Contact

13. My Ginger Garlic Kitchen

My Ginger Garlic Kitchen My name is Anupama Paliwal, and I welcome you to My Ginger Garlic Kitchen, an Indian Fusion Food Blog, where I share my recipes, food styling tips, and how to's. Here, you will discover exemplary video tutorials and recipes of Indian and western food with spices and herbs.
mygingergarlickitchen.com
Facebook Followers 163.1KTwitter Followers 704Instagram Followers 7K Frequency 5 posts / week Domain Authority 42 Get Email Contact

14. Easy Cooking with Molly

Easy Cooking with Molly Welcome to my Flavorful Fusion Kitchen. Find Authentic Indian recipes with a lighter version, Fusion of Spices and World Cuisine.
easycookingwithmolly.com
Facebook Followers 18.8KTwitter Followers 6.8KInstagram Followers 11.6K Frequency 2 posts / month Domain Authority 42 Get Email Contact

15. My Food Story

My Food Story Indian food blog with healthy breakfast, dinner, dessert and drink recipes for the busy cook.
myfoodstory.com
Facebook Followers 130.9KTwitter Followers 1.5KInstagram Followers 186.8K Frequency 2 posts / month Domain Authority 56 Get Email Contact

16. Sharmis Passions

Sharmis Passions A website with many south indian and north indian recipes, baking recipes and few international recipes....all recipes include stepwise pictures which makes it easy even for beginners to cook.Hope you enjoy your time here!
sharmispassions.com
Facebook Followers 394.6KTwitter Followers 2.6KInstagram Followers 121.6K Frequency 2 posts / month Domain Authority 46 Get Email Contact

17. Zesty South Indian Kitchen

Zesty South Indian Kitchen I am Swathi who loves to explore cuisines from all over the world. Whenever possible I try to to give an Indian touch to several of the world cuisine.
zestysouthindiankitchen.com
Facebook Followers 41.2KTwitter Followers 5.3KInstagram Followers 7.6K Frequency 1 post / month Domain Authority 40 Get Email Contact

18. Yummy Food

Yummy Food Welcome to my blog. I am Lubna Karim, the face behind 'Yummy Food'. A science student turned into a management graduate finally ending up in the kitchen, experimenting, and experiencing the joys of cooking.
kitchenflavours.net
Facebook Followers 7.9KTwitter Followers 1.2KInstagram Followers 3.8K Frequency 1 post / week Since Jul 2008 Domain Authority 30 Get Email Contact

19. Indian Simmer

Indian Simmer A website dedicated to bringing the Indian food lovers together, around one community table. Indian Simmer has since been featured in a multitude of publications and received numerous recognitions, most notably as a winner of Saveur Best Food Blog awards in 2014. In 2015, expanding on the idea of creating a space for Indian food lovers around the world, it had a rebirth for Indian recipes.
indiansimmer.com
Facebook Followers 52.1KTwitter Followers 2.5KInstagram Followers 7.3K Frequency 1 post / day Domain Authority 49 Get Email Contact

20. Kannamma Cooks

Kannamma Cooks A Collection of Tamil Nadu Recipes, Tamil Cuisine, Kongunad Recipes. Easy Vegetarian and Non Vegetarian dishes with step by step pictures. The Kannamma Cooks share Latest Recipes Tawa Fried Cheese Veggie Roll Home-made vegetable rolls made with stuffed vegetables and cheese.
kannammacooks.com
Facebook Followers 507.1KTwitter Followers 5.8KInstagram Followers 113.6K Frequency 4 posts / month Domain Authority 39 Get Email Contact

21. Cooking with Thas

Cooking with Thas A step-by-step visual guide to effortless cooking. Thas presents simple and healthy recipes along with traditional recipes from her family.
thasneen.com
Facebook Followers 107.5KTwitter Followers 839 Frequency 1 post / day Domain Authority 41 Get Email Contact

22. Ruchiskitchen

Ruchiskitchen A food blog all about healthy, simple and innovative new recipes. Collection of world cuisines featuring everything from baking to cooking basics, home organization and cooking tips.
ruchiskitchen.com
Facebook Followers 23.1KTwitter Followers 2.1KInstagram Followers 22.4K Frequency 5 posts / quarter Domain Authority 48 Get Email Contact

23. Blend with Spices

Blend with Spices A website with many traditional South Indian and North Indian recipes for everyday cooking. You will also find some eggless baking recipes for beginners. Lots of recipes with photographs!
blendwithspices.com
Facebook Followers 250.5KTwitter Followers 1.3KInstagram Followers 5.2K Frequency 1 post / week Domain Authority 40 Get Email Contact

24. My Tasty Curry

My Tasty Curry An Indian Food blog Tasty recipes and Healthy Cooking Recipe
mytastycurry.com
Facebook Followers 746.8KTwitter Followers 150Instagram Followers 234.6K Frequency 3 posts / month Domain Authority 38 Get Email Contact

25. F and B Recipes

F and B Recipes F and B Recipes is a leading Food and Wellness blog. We share food recipes, beverage recipes, food guides and health and wellness articles.
fandbrecipes.com
Facebook Followers 1.5KTwitter Followers 202Instagram Followers 8.2K Frequency 4 posts / month Since Sep 2020 Domain Authority 62 Get Email Contact

26. Passionate About Baking

Passionate About Baking Deeba Rajpal Food writer, stylist and recipe developer
passionateaboutbaking.com
Facebook Followers 18.2KTwitter Followers 7Instagram Followers 826.1K Frequency 4 posts / month Domain Authority 50 Get Email Contact

27. Indian Food Freak

Indian Food Freak India's leading travel, lifestyle and restaurant review website committed to share enriching content. Find restaurant reviews of the major restaurants in Delhi, Gurgaon, Noida & NCR.
indianfoodfreak.com
Facebook Followers 14.8KTwitter Followers 4.9K Frequency 3 posts / week Domain Authority 32 Get Email Contact

28. The Tastes of India

The Tastes of India The Tastes of India is an Indian recipes food blog by Blogger, Podcaster & Home Business Owner Puja Darshan, with more than 600 tasty Indian Recipes. Here you will find Tasty Indian Vegetarian Recipes for your Breakfast, Lunch & Dinner and also some Easy Kids Recipes that your little ones will fall in love with.
thetastesofindia.com
Facebook Followers 4.1KTwitter Followers 3.9KInstagram Followers 7.5K Frequency 3 posts / month Domain Authority 31 Get Email Contact

29. Subbu's Kitchen

Subbu's Kitchen Subbu's Kitchen is an Indian vegetarian kitchen with a variety of traditional and current Indian recipes presented in simple step-by-step photographs that may enable even the most inexperienced cook cook like a pro. The goal of this blog is to motivate you to cook by demonstrating how simple it is.
subbuskitchen.com
Facebook Followers 623.9KTwitter Followers 307Instagram Followers 16.5K Frequency 3 posts / quarter Domain Authority 33 Get Email Contact

30. Jeyashri's Kitchen

Jeyashri's Kitchen Jeyashri's Kitchen is vegetarian food blog with over 1000 plus recipes with detailed step wise instructions. This website has a good collection of South Indian, North Indian and international recipes and also includes Eggless baking recipes too.
jeyashriskitchen.com
Facebook Followers 368.8KInstagram Followers 62.2K Frequency 1 post / week Since Aug 2009 Domain Authority 38 Get Email Contact

31. Quiche 'n' Tell

Quiche 'n' Tell A food blog with easy yet deliciously different recipes for Breakfast, Lunch and Dinner to fulfill your every food craving.
quichentell.com
Facebook Followers 58Twitter Followers 191Instagram Followers 278 Frequency 1 post / month Since Jul 2013 Domain Authority 28 Get Email Contact

32. Vidhya's Home Cooking

Vidhya's Home Cooking A vegetarian food blog with unique and interesting recipes from all over the world mainly focused on South Indian Cuisine. From traditional, authentic recipes to fusion and eggless bakes, you can find it all in Vidhya's vegetarian kitchen.
vidhyashomecooking.com
Facebook Followers 39.1KTwitter Followers 1.5KInstagram Followers 90.4K Frequency 1 post / month Domain Authority 37 Get Email Contact

33. Cook's Hideout

Cook's Hideout This blog is my recipe journal(mostly Andhra recipes) where I write about the new (and old) recipes that I have tried in my kitchen. Most of the dishes here are Indian, focusing more on South Indian cuisine.
cookshideout.com
Facebook Followers 5KTwitter Followers 903Instagram Followers 1.9K Frequency 1 post / week Domain Authority 38 Get Email Contact

34. Chitra's Food Book

Chitra's Food Book Covers healthy, easy, South Indian, North Indian, International and eggless baking recipes with step by step photos.
chitrasfoodbook.com
Facebook Followers 189.7KTwitter Followers 1.2KInstagram Followers 46.2K Frequency 1 post / month Since Jan 2010 Domain Authority 34 Get Email Contact

35. Give Me Some Spice

Give Me Some Spice Welcome to Give Me Some Spice. It features Authentic Traditional Indian Vegetarian Recipes with step-by-step instructions by Mina Joshi. Her blog features quick and easy time saving recipes. Her mission is to share her authentic recipes.
givemesomespice.com
Facebook Followers 9.9KTwitter Followers 1.5KInstagram Followers 1.5K Frequency 4 posts / year Since Apr 2009 Domain Authority 27 Get Email Contact

36. Flavor Quotient

Flavor Quotient A blog to share my passion for cooking and creating something to delight others..
flavorquotient.com
Facebook Followers 2.8KTwitter Followers 348 Frequency 1 post / month Domain Authority 36 Get Email Contact

37. Pooja's Cookery

Pooja's Cookery Welcome to my blog. I am a passionate food blogger, Recipe Creator , Food Stylist and Food Photographer . Love to cook and keep trying my hands on different dishes in kitchen.
poojascookery.com
Facebook Followers 7KTwitter Followers 1.3KInstagram Followers 1.4K Frequency 1 post / month Domain Authority 26 Get Email Contact

38. Ministry of Curry

Ministry of Curry Transport your kitchen to a New World and learn how to make incredible Indian recipes and international dishes through simple step-by-step instructions and expert tips! Ministry of Curry is food blog that makes cooking fun and simple - a perfect dish every time! Their easy and fail-proof recipes deliver authentic flavors using modern and innovative techniques.
ministryofcurry.com
Facebook Followers 574.5KTwitter Followers 329Instagram Followers 246.4K Frequency 1 post / week Since Oct 2015 Domain Authority 38 Get Email Contact

39. The Big Sweet Tooth

The Big Sweet Tooth A blog where I share my trial and errors in my kitchen!!! Welcome to my little space, filled with awesome food and sweet nothings...
thebigsweettooth.com
Facebook Followers 9.9KTwitter Followers 185Instagram Followers 8.8K Frequency 1 post / week Since Jan 2013 Domain Authority 34 Get Email Contact

40. Lisa's Vegetarian Kitchen

Lisa's Vegetarian Kitchen A vegetarian cook for many years, Lisa shares her collection of delicious and healthy recipes at foodandspice.blogspot.com, with an emphasis on spicy Indian dishes.
foodandspice.com
Facebook Followers 6.2KTwitter Followers 788 Frequency 1 post / month Domain Authority 45 Get Email Contact

41. Spiceitupp

Spiceitupp No complicated #cooking in my kitchen! Simple,fuss-free dishes made with love & a dash of spice! blogger on how to cook Indianfood & Use spices with ease!
spiceitupp.com
Facebook Followers 638Twitter Followers 283Instagram Followers 1.6K Frequency 3 posts / year Domain Authority 24 Get Email Contact

42. Nitha Kitchen

Nitha Kitchen Nitha Kitchen covers traditional and fusion Indian/International recipes. Most of them are healthy with step by step pictures and explanations.
nithaskitchen.com
Facebook Followers 7.8KTwitter Followers 800Instagram Followers 2.9K Frequency 1 post / week Since Mar 2012 Domain Authority 21 Get Email Contact

43. Debjanir Rannaghar

Debjanir Rannaghar I have started my blog 'Debjanir Rannaghar' in 2011 with an intention to keep records of my cooking ventures and life-stories related to food and obviously, for sharing those with like-minded foodies/food bloggers and to be precise the Blog Debjanir Rannaghar is a novice attempt for sharing Food thoughts
kitchenofdebjani.com
Facebook Followers 11.1KTwitter Followers 1.6KInstagram Followers 104.4K Frequency 1 post / month Domain Authority 31 Get Email Contact

44. Aharam

Aharam I am a vegetarian (egalitarian, I guess, because I bake using eggs), but I watch all kinds of cooking shows and read all kinds of culinary arts books because the techniques fascinate me. I also find chefs in most restaurants only too glad to share tips and tricks, and regularly badger them! I hope you enjoy my posts as much as I enjoy writing them.
aahaaramonline.com
Twitter Followers 949 Frequency 1 post / week Domain Authority 27 Get Email Contact

45. Cookilicious

Cookilicious Focusing on easy-to-make vegetarian/vegan meals, a healthy mix of recipes using modern cooking trends, and family classics. Cookilicious is a vegetarian and vegan recipe blog by Priya who enjoys cooking from scratch using fresh ingredients.
cookilicious.com
Facebook Followers 15KTwitter Followers 1KInstagram Followers 26.3K Frequency 1 post / week Domain Authority 39 Get Email Contact

46. Culinary Xpress

Culinary Xpress Hi, I am Alka Jena, a Government Official by morning and culinary custodian by evening - a role in which I discover stories, curate recipes, get intimate with ingredients, and cook & photograph flourishingly. Welcome to CulinaryXpress, the food space where the magic comes to life.
culinaryxpress.com
Facebook Followers 4.1KTwitter Followers 482Instagram Followers 37.7K Frequency 18 posts / year Since Sep 2014 Domain Authority 29 Get Email Contact

47. Culinary Xpress - Creating Magic with Everyday Cooking

Culinary Xpress - Creating Magic with Everyday Cooking I am Alka, Blogger, Photographer, Food Stylist, Recipe Developer and the driving force behind this blog. Here, I share my passion for home cooked food which I capture through my lenses . I am a self-taught cook and a Photographer who try to create magic with everyday cooking.
culinaryxpress.com
Facebook Followers 4KTwitter Followers 482Instagram Followers 37.7K Frequency 15 posts / year Since Aug 2014 Domain Authority 29 Get Email Contact

48. Curry Nation

Curry Nation Curry Nation is a food blog by Priya. This website is all about food. Recipes shared here are tried and tasted.
priyascurrynation.com
Facebook Followers 18KInstagram Followers 7.8K Frequency 1 post / month Domain Authority 18 Get Email Contact

49. Cooking From My Heart

Cooking From My Heart One stop shop for all easy & simple tested recipes!
cookingfromheart.com
Facebook Followers 15KTwitter Followers 296Instagram Followers 81.2K Frequency 1 post / month Domain Authority 32 Get Email Contact

50. Traditionally Modern Food

Traditionally Modern Food A vegetarian blog with healthy South Indian and North Indian recipes, low-calorie sweets and desserts, all explained with step-by-step pictures.
traditionallymodernfood.com
Facebook Followers 30.1KTwitter Followers 731Instagram Followers 267.1K Frequency 1 post / week Since Apr 2014 Domain Authority 21 Get Email Contact

51. Vegetarian Tastebuds

Vegetarian Tastebuds We are Bela and Drashti Dholakia, the mother-and-daughter team behind this blog. Welcome to Vegetarian Tastebuds, a food blog on vegetarian recipes. Here you can find delicious vegetarian recipes from Indian as well as world cuisine, which are super easy to follow and prepare.
vegetariantastebuds.com
Facebook Followers 14.5KTwitter Followers 121 Frequency 1 post / week Domain Authority 25 Get Email Contact

52. Spoon Fork And Food

Spoon Fork And Food This blog is a collection of good food and fond memories that remind me of my mum's home cooked food, those that transport me to distant moments of childhood or shared happy times with loved ones, friends and family.
spoonforkandfood.com
Facebook Followers 5.8KTwitter Followers 2Instagram Followers 105.1K Frequency 2 posts / quarter Domain Authority 32 Get Email Contact

53. Simmer to Slimmer

Simmer to Slimmer An Indian food blog with meal planning tips. From easy vegetarian dishes to delicious chicken curries, our step-by-step recipes will help you make Indian food for your family in no time.
simmertoslimmer.com
Facebook Followers 32.5KTwitter Followers 402Instagram Followers 4.5K Frequency 3 posts / week Domain Authority 34 Get Email Contact

54. CHARUS CUISINE

CHARUS CUISINE A collection of Indian recipes with special focus on ethnic Karnataka and other South Indian and North Indian recipes
charuscuisine.com
Facebook Followers 24.5KTwitter Followers 582 Frequency 1 post / month Domain Authority 15 Get Email Contact

55. GKFoodDiary | Indian Food Recipes for Babies, Toddlers and Kids

GKFoodDiary | Indian Food Recipes for Babies, Toddlers and Kids A Healthy Indian Food Blog for Babies, Toddlers and Kids with step by step pictures. Homemade Indian baby food recipes , Easy and healthy Indian recipes
gkfooddiary.com
Facebook Followers 285.3KTwitter Followers 73Instagram Followers 9.7K Frequency 2 posts / month Domain Authority 26 Get Email Contact

56. The Secret Ingredient

The Secret Ingredient Everyday recipes to entice your taste buds. From authentic Indian cuisines to global experimental food.
thesecretingredient.in
Facebook Followers 16.2K Frequency 1 post / quarter Domain Authority 23 Get Email Contact

57. Mildly Indian

Mildly Indian Trot around the world, savor the flavors.
mildlyindian.com
Facebook Followers 688Twitter Followers 95 Frequency 5 posts / month Domain Authority 16 Get Email Contact

58. Cooking With Shobana

Cooking With Shobana Shobana P Rao Cooking Enthusiast & Food Blogger, sharing a collection of Indian recipes, some cooking tips and useful hints.
cookingwithshobana.com
Facebook Followers 16.6KTwitter Followers 218Instagram Followers 1.1K Frequency 2 posts / month Domain Authority 16 Get Email Contact

59. Yummy Indian Kitchen

Yummy Indian Kitchen Indian Food blog with Indian Vegetarian Recipes, Indian Non Veg Recipes, South Indian Recipes and Indian regional cuisine.
yummyindiankitchen.com
Facebook Followers 506.9KTwitter Followers 80 Frequency 1 post / month Domain Authority 34 Get Email Contact

60. gosumItup | with all bells and whistles

gosumItup | with all bells and whistles Sumit Malhotra Goes & Sums it Up - Reviews, Recipes, Travels & Rants. Sumit Malhotra's expression engine that records my experiences, cooking & more.
gosumitup.com
Twitter Followers 404Instagram Followers 631 Frequency 1 post / month Domain Authority 13 Get Email Contact

61. The Ghee Spot

The Ghee Spot With the hyper-convenience of modern life, many of us settle for the Indian takeout around the corner that pretends to be Punjabi. Enjoying a home-cooked Punjabi meal is now a luxury and nearly impossible to find. At The Ghee Spot, we're keeping it simple and traditional-ish. Things I grew up with as a typical Punjabi farm kid, with some fusion recipes on the side.
thegheespot.net
Facebook Followers 106Twitter Followers 50 Frequency 1 post / week Domain Authority 9 Get Email Contact

62. Everyday Nourishing Foods

Everyday Nourishing Foods If you want to make quick and simple recipes without compromising on taste and nutrient quotient, you are at the right place. This blog will have healthy vegetarian and vegan recipes made using local and seasonal fruits and veggies, whole grains, beans, lentils, healthy fats, that can be prepared at home from scratch without using any readymade or store-bought stuff.
everydaynourishingfoods.com
Facebook Followers 583Instagram Followers 779 Frequency 4 posts / month Since May 2018 Domain Authority 17 Get Email Contact

63. Madappalli - Temple's Kitchen

Madappalli - Temple's Kitchen This blog provides you the best quality of Vegetarian Onion and Garlic Free Recipes, and multi cuisine Recipes
sadhanakitchen.blogspot.com
Facebook Followers 4.6K Frequency 2 posts / month Domain Authority 23 Get Email Contact

64. SmiShri's Carpe Diem-Spicy Eats

SmiShri's Carpe Diem-Spicy Eats Welcome to SmiShri's Carpe Diem Spicy Eats! Experience the quick and easy way to spice up your life with delicious Indian Vegetarian Cooking ...Simply Enjoy Maadi!!
smishri.blogspot.com
Facebook Followers 2.5K Frequency 6 posts / month Since Nov 2012 Domain Authority 12 Get Email Contact

65. Hyderabadi Ruchulu

Hyderabadi Ruchulu The goal of Hyderabad Ruchulu is to shed some light on Hyderabadi Recipes, for those who always want to find out what makes Hyderabadi Food so unique.
hyderabadiruchulu.com
Facebook Followers 565.8KInstagram Followers 181 Frequency 3 posts / quarter Domain Authority 15 Get Email Contact

66. Vanita's Corner

Vanita's Corner Vanita's Corner is all about simple recipes, gardening tips and home remedies.
vanitascorner.com
Facebook Followers 28.4KTwitter Followers 11 Frequency 1 post / week Domain Authority 22 Get Email Contact

67. My foodarama

My foodarama The recipe place for Indian food, cakes, bakes, and fusion cuisine. Indian recipes, non-vegetarian recipes, video recipes, Indian food, kids lunch box ideas, kids meals, cake recipes, vegan recipes, vegetarian recipes, and much more.
reshmaseetharam.com
Facebook Followers 88.6KTwitter Followers 37Instagram Followers 1.5K Frequency 3 posts / month Since Oct 2010 Domain Authority 11 Get Email Contact

68. Divya's Nalabhagam

Divya's Nalabhagam Simple vegetarian, nutritious and tasty home style recipes.
divyasnalabhagam.com
Twitter Followers 251Instagram Followers 1.3K Frequency 1 post / week Domain Authority 12 Get Email Contact

69. At My Kitchen

At My Kitchen Follow this blog to get delicious food recipes.
atmykitchen.net
Twitter Followers 7Instagram Followers 1.2K Frequency 1 post / month Domain Authority 16 Get Email Contact

70. Poetry of Spices

Poetry of Spices Poetry Of Spices authored by Mini is a food blog that shares daily creative and easy, healthy vegetarian and vegan recipes with a flavor of Indian spices. Explore finely curated menus and recipes that inspire home cooking and nudge families around the world towards a more ethical, sustainable, and healthy dinner table.
poetryofspices.com
Facebook Followers 672Instagram Followers 114.1K Frequency 3 posts / week Domain Authority 8 Get Email Contact

71. Cookery Expressions

Cookery Expressions Cookery Expressions is the ideal baking school if you'd like to know more but only have a devoted amount of time to learn. Ms. Sharmila is well known for her superb all-around baking abilities.
cookeryexpressions.co.in
Facebook Followers 11.4KTwitter Followers 633Instagram Followers 566 Frequency 3 posts / month Domain Authority 15 Get Email Contact

72. The Corriander Leaf

The Corriander Leaf Best food articles with Hundreds of Simple Healthy Indian Food Tips, Recipes, and a lot more. The Corriander Leaf Group was established in 2011 in Yangon, Myanmar, especially known for Indian Family Dining.
corrianderleaf.com
Facebook Followers 20.4K Frequency 3 posts / month Domain Authority 20 Get Email Contact

73. Aroma of Kitchen

Aroma of Kitchen Hello and Namaste. I am Urvashi Singh. Cooking is my hobby and my husband inspire me to explore this from our Kitchen to the world. The aroma of Kitchen is a food blog that covers mostly Indian but some International cuisine as well. We will always share recipes that are already cooked and tasted by us.
aromaofkitchen.com
Twitter Followers 11Instagram Followers 2.9K Frequency 10 posts / year Domain Authority 12 Get Email Contact

74. Kanupriya

Kanupriya Covers Nutrition Planning, Pregnancy, Lactation, Infertility and Children. Author Kanupriya is a Sr. Consultant Nutritionist & Dietitian.
kanupriyakhanna.in
Facebook Followers 1.5KTwitter Followers 163Instagram Followers 614 Frequency 1 post / week Domain Authority 12 Get Email Contact

75. Pune Food Spot

Pune Food Spot Follow Pune Food Spot to get articles related to food trends in Pune and Mumbai.
punefoodspot.com
Facebook Followers 135Twitter Followers 2.6K Frequency 1 post / month Since Jun 2015 Domain Authority 6 Get Email Contact

Show 76 to 637

Indian Food Bloggers

Top Authors, Journalists, and Publishers covering Indian Food. Get Spreadsheet
Blogger NameEmailBlog LinkTotal Blog Posts
Sanjeev Kapoor Khazanayoutube.com808
Sasmitafirsttimercook.com143
Thasthasneen.com80
Vidya Srinivasantraditionallymodernfood.com76
Priyankaflavorquotient.com61
Richaveganricha.com60
NishaMadhulikayoutube.com57
Mini Bhuwaniapoetryofspices.com48
Archana Doshiarchanaskitchen.com46
Aarthiyummytummyaarthi.com45
Sharmilee Jsharmispassions.com44
Tarla Dalalyoutube.com43
Vanita's Cornervanitascorner.com43
Anupama paliwalmygingergarlickitchen.com38
Vaishaliholycowvegan.net30
Sangeetha Velvegveganmeat.com28
Archana's Kitchenarchanaskitchen.com27
Jeyashri sureshjeyashriskitchen.com26
Rishika Komarlamyfoodstory.com25
Divya's Nalabhagamdivyasnalabhagam.com25
Deebapassionateaboutbaking.com24
Archanaministryofcurry.com24
Rekha Kakkarmytastycurry.com22
Arunaaahaaramonline.com22
Dipti Tharwanifandbrecipes.com22
Anushree Shettysimmertoslimmer.com22
VegCookBook by Praveenavegcookbook.net21
Rumi Mahanta Duttarumicooks.com21
Babita Singhhealthicallykitchen.com21
Nisa Homeynisahomey.com18
Suguna Vinodhkannammacooks.com18
Sugi's Kitchen & Animatesyoutube.com16
Priyacookilicious.com15
pawansoniindianfoodfreak.com15
Debjanikitchenofdebjani.com15
Pooja Nadkarnipoojascookery.com15
Hari Chandana Ponnaluriblendwithspices.com14
Pujathetastesofindia.com14
Anupamamygingergarlickitchen.com13
Helene Dsouzamasalaherb.com13
Swathizestysouthindiankitchen.com13
kanupriya123kanupriyakhanna.in13
Preeti Gargsimplytadka.com12
Vahchef - VahRehVahyoutube.com12
Molly Kumareasycookingwithmolly.com12
Sumit Malhotragosumitup.com12
Sheewangi Aryarailrecipe.com12
Ruchiruchiskitchen.com11
mistressgheethegheespot.net11
Lubna Karimkitchenflavours.net11
Load 51 to 100 of 637 Bloggers